CookSnap is coming soon — Join the waitlist →

Fiery Xinjiang Beef Stir-Fry

Tender beef seared over high heat with cumin, chili flakes, and bell peppers in a crispy-edged skillet finish. A 20-minute weeknight take on the bold, spiced street-food classic.

Total time
20 min
Servings
2
Calories
385
Protein
38g
Fiery Xinjiang Beef Stir-Fry
boldsatisfyingchinesebeefcrispytendercharredweeknight

Ingredients

  • ¾ lb beef flank or sirloin, sliced thin against the grain
  • 1 large red bell pepper, sliced into thick strips
  • 1.5 tsp cumin seeds
  • ¾ tsp chili flakes (Xinjiang-style or standard red pepper flakes)
  • 2 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 3 whole scallions, cut into 1-inch pieces

Instructions

  1. 1

    Pat beef dry with paper towels. Season generously with salt and black pepper.

  2. 2

    Heat 2 tbsp oil in a 12-inch skillet over high heat until it just begins to smoke, ~2 minutes.

  3. 3

    Working in two batches, sear beef 90 seconds per side without stirring. Set aside on a plate.

  4. 4

    Add cumin seeds to the skillet, let them toast and pop for 30 seconds until fragrant.

  5. 5

    Stir in bell pepper, chili flakes, soy sauce, and vinegar. Cook 3 minutes, tossing occasionally, until peppers char at the edges.

  6. 6

    Return beef to the skillet with scallions. Toss for 30 seconds to warm through, then serve immediately.

Tools you’ll need

  • 12-inch cast iron or stainless steel skillet
  • chef's knife
  • cutting board
  • paper towels
  • wooden spoon or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.