CookSnap is coming soon — Join the waitlist →
Back to recipes

Sichuan Spicy Beef Stir-Fry

Tender beef with a bold, numbing heat from Sichuan peppercorns and chiles. Ready in 30 minutes with pantry staples and a bright finish of scallions.

Total time
30 min
Servings
2
Calories
420
Protein
38g
Sichuan Spicy Beef Stir-Fry
boldsatisfyingchinesebeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef flank steak
  • 3 tablespoons soy sauce
  • 1.5 tablespoons rice vinegar
  • 4 cloves garlic, minced
  • 2 whole dried red chiles (or red pepper flakes)
  • 1 teaspoon Sichuan peppercorns
  • 3 whole scallions, chopped
  • 2 tablespoons neutral oil

Instructions

  1. 1

    Place the beef on the cutting board with the grain running left to right. Slice against the grain (from bottom to top) into strips about 1/8-inch thick, the thickness of a dime, cutting straight through the meat.

  2. 2

    In a small bowl, whisk together 3 tablespoons soy sauce and 1.5 tablespoons rice vinegar until they blend into a single liquid.

  3. 3

    Mince the garlic until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  4. 4

    If using whole dried red chiles, break them in half and scrape out the seeds with a small spoon to reduce the heat, then crush the pieces into small, uneven flakes about the size of a pea.

  5. 5

    Heat 2 tablespoons neutral oil in a 12-inch skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 90 seconds.

  6. 6

    Add the beef strips in a single layer and cook without stirring for 2 minutes until the bottom surface turns dark brown, like caramelized toast. Stir and cook for another 1 minute until mostly cooked through. Transfer to a plate.

  7. 7

    Return the empty skillet to medium heat and add the minced garlic, crushed chiles, and 1 teaspoon Sichuan peppercorns. Stir continuously for 30 seconds until the spices smell intensely fragrant and the garlic turns light golden.

  8. 8

    Pour the soy-vinegar sauce into the skillet and scrape up any stuck-on brown bits from the bottom with a wooden spoon.

  9. 9

    Return the cooked beef to the skillet and toss constantly for 1 minute until the sauce coats the beef and thickens slightly.

  10. 10

    Chop the scallions into 1/2-inch pieces by slicing them crosswise, cutting through the white parts and light green parts together.

  11. 11

    Transfer the beef and sauce to a serving plate or bowl and scatter the chopped scallions over the top in an even layer.

Tools you’ll need

  • cutting board
  • sharp knife
  • small bowl
  • whisk
  • 12-inch skillet
  • wooden spoon
  • plate
  • serving bowl or plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.