CookSnap is coming soon — Join the waitlist →

Mala Xiang Guo (Numbing-Spicy Stir-Fry)

A fiery Sichuan stir-fry with tender pork, crispy aromatics, and the signature numbing-spicy mala heat from Sichuan peppercorns and chiles. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
28g
Mala Xiang Guo (Numbing-Spicy Stir-Fry)
boldquickchineseporkcrispytenderweeknightstir-fry

Ingredients

  • ½ lb pork shoulder or belly, thinly sliced
  • 1 tbsp Sichuan peppercorns
  • 4 whole dried red chiles (whole)
  • 4 whole garlic cloves, minced
  • 2 tbsp soy sauce
  • 3 tbsp neutral oil (vegetable or peanut)

Instructions

  1. 1

    Place the pork slices on a cutting board and pat them dry with paper towels so they brown better in the pan.

  2. 2

    Crush the Sichuan peppercorns lightly with the side of a knife or in a mortar to release their oils and flavor.

  3. 3

    Cut each dried red chile in half lengthwise and remove the seeds with your fingertip under running water to reduce bitterness.

  4. 4

    Heat 1 tablespoon of oil in a 12-inch skillet over high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. 5

    Add the pork slices in a single layer and let them sit without stirring for 2 minutes until the bottom edges turn brown.

  6. 6

    Stir the pork and cook for another 1 to 2 minutes until no pink remains, then transfer to a clean plate.

  7. 7

    Reduce heat to medium and add the remaining 2 tablespoons of oil to the same skillet; swirl to coat the bottom.

  8. 8

    Add the crushed Sichuan peppercorns and dried chiles, then stir for 30 seconds until fragrant.

  9. 9

    Add the minced garlic and stir for 15 seconds, watching carefully so it does not burn.

  10. 10

    Return the cooked pork to the skillet and pour in 2 tablespoons of soy sauce; toss everything together for 1 minute to coat evenly.

  11. 11

    Taste and add salt and pepper if needed, then transfer to a serving bowl and serve immediately while hot.

Tools you’ll need

  • 12-inch skillet with lid
  • cutting board
  • chef's knife
  • mortar and pestle (optional, or use the side of a knife)
  • paper towels
  • wooden spoon or spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.