CookSnap is coming soon — Join the waitlist →
Back to recipes

Spicy Cumin Beef Stir-Fry

Hot, smoky, and perfectly charred beef with cumin and chili crisp in under 15 minutes. A TikTok-viral Xinjiang take that skips the lengthy technique.

Total time
14 min
Servings
2
Calories
420
Protein
38g
Spicy Cumin Beef Stir-Fry
boldsatisfyingchinesebeefcrispytendercharredweeknight

Ingredients

  • ¾ lb beef sirloin or flank steak
  • 2 tsp cumin seeds (or ground cumin)
  • 2 tbsp chili crisp (like Lao Gan Ma)
  • 4 stalks scallions
  • 4 cloves garlic
  • 1 tbsp sesame oil

Instructions

  1. 1

    Slice the beef against the grain into 1/4-inch-thick strips. Toss with 1 tsp cumin, salt, and pepper.

  2. 2

    Heat a 12-inch skillet over medium-high until it's very hot, about 90 seconds. Working in batches, sear the beef 45 seconds per side without stirring — edges should look charred.

  3. 3

    Push beef to the side. Add minced garlic and remaining 1 tsp cumin to the pan; cook 30 seconds until fragrant.

  4. 4

    Toss beef with garlic and cumin. Add chili crisp and sliced scallion whites, stirring constantly for 45 seconds.

  5. 5

    Remove from heat. Drizzle sesame oil and scatter scallion greens over the top.

  6. 6

    Serve immediately over rice or with flatbread.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.