Avocado and Beef Sandwich
A quick and satisfying sandwich with a crispy breaded beef patty, creamy avocado slices, and fresh lettuce. Perfect for a fast lunch or dinner.
- Total time
- 15 min
- Servings
- 2
- Calories
- 550
- Protein
- 25g
comfortingquickAmericanbeefcrispycreamyweeknightsandwich
Ingredients
- 2 breaded beef patties
- 1 avocado
- 4 lettuce leaves
- 4 slices sandwich bread
- 2 tbsp mayonnaise
Instructions
- 1
Cook the 2 breaded beef patties in a skillet over medium-high heat until golden brown and cooked through, about 4 minutes per side.
- 2
Slice the 1 avocado in half, remove the pit, and cut the flesh into thin slices.
- 3
Spread 1 tbsp mayonnaise on each of the 4 bread slices.
- 4
Place the cooked patties on 2 bread slices, top with avocado slices and 2 lettuce leaves each, then close with the remaining bread slices.
- 5
Serve immediately.
Tools you’ll need
- skillet
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
