CookSnap is coming soon — Join the waitlist →

Air Fryer Pizza

Crispy-bottomed pizza ready in 15 minutes using store-bought dough or naan as the base. Top with sauce, cheese, and toppings, then air-fry until the crust is golden and cheese melts.

Total time
15 min
Servings
2
Calories
420
Protein
14g
Air Fryer Pizza
casualquickamericanvegetariancrispymeltyweeknightpizza

Ingredients

  • 2 pieces or 8 oz naan or pizza dough (store-bought)
  • ½ cup marinara sauce
  • 1 cup mozzarella cheese, shredded
  • 1 tbsp olive oil
  • 1 tsp fresh basil or Italian seasoning
  • 1 to taste salt and pepper

Instructions

  1. 1

    Brush both sides of naan or dough lightly with olive oil.

  2. 2

    Place in air fryer basket at 380°F for 3 minutes until lightly firm.

  3. 3

    Spread marinara sauce thinly on each piece, leaving a 1/2-inch border.

  4. 4

    Top evenly with shredded mozzarella, dividing between the two pieces.

  5. 5

    Sprinkle with Italian seasoning, salt, and pepper.

  6. 6

    Air-fry at 380°F for 4–5 minutes until cheese bubbles and crust browns.

  7. 7

    Remove from basket and rest 1 minute, then slide onto a cutting board.

  8. 8

    Serve immediately.

Tools you’ll need

  • air fryer basket (or rack)
  • pastry brush or small spoon
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.