CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Tortilla Fold Pizza

A handheld snack that transforms a flour tortilla into a crispy, cheesy pocket filled with pizza toppings. Ready in 10 minutes with no oven required.

Total time
10 min
Servings
2
Calories
420
Protein
14g
Crispy Tortilla Fold Pizza
casualquickmexicanamericanvegetariancrispymeltyweeknight

Ingredients

  • 2 large (10-inch) flour tortillas
  • ⅓ cup pizza sauce or marinara
  • 1 cup shredded mozzarella cheese
  • ½ cup pepperoni slices (optional), or other pizza toppings
  • 1 tablespoon butter

Instructions

  1. 1

    Place a 10-inch skillet over medium-high heat and let it sit for 30 seconds until it feels warm when you hold your hand 2 inches above the surface.

  2. 2

    Lay one tortilla flat on a clean cutting board and spread 2.5 tablespoons of pizza sauce across the entire surface, leaving a 0.5-inch border around the edges.

  3. 3

    Sprinkle 0.5 cup of mozzarella cheese evenly across the sauce, then scatter 0.25 cup of pepperoni slices (or your chosen toppings) across the cheese.

  4. 4

    Fold the tortilla in half like closing a book, pressing the edge of the top half down onto the bottom half so the filling stays inside.

  5. 5

    Add 0.5 tablespoon of butter to the hot skillet and let it melt and coat the bottom evenly, about 15 seconds.

  6. 6

    Carefully slide the folded tortilla into the skillet with the fold facing left, so the open edges face right and heat can crisp all exposed surfaces.

  7. 7

    Cook without moving it for 2–3 minutes until the bottom looks the color of toast—deep golden brown with some darker spots—and you can smell the butter turning nutty.

  8. 8

    Flip the tortilla using a wide spatula, supporting both halves so the filling doesn't spill out, and cook the other side for 2–3 minutes until it matches the first side's color.

  9. 9

    Slide the cooked fold onto a cutting board and let it rest for 1 minute so the cheese can cool slightly and set inside the tortilla.

  10. 10

    Repeat steps 2–9 with the second tortilla, the remaining pizza sauce, cheese, and pepperoni, plus the remaining butter.

  11. 11

    Cut each cooked tortilla in half diagonally by pressing a sharp knife straight down through the middle from the fold side to the open edge, creating two triangles.

  12. 12

    Plate the four triangles with the crispy side facing up so the golden surface shows, and serve immediately while the cheese is still warm and slightly gooey inside.

Tools you’ll need

  • 10-inch nonstick or cast-iron skillet
  • cutting board
  • butter knife or small spoon
  • wide spatula
  • sharp chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.