10-Min Pita Pizza
Crispy pita bread topped with tangy pizza sauce and melted mozzarella, ready in minutes. The fastest pizza night—no dough-rolling required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 340
- Protein
- 15g
quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
- 2 rounds pita bread
- 4 tbsp pizza sauce
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Place pita rounds on a baking sheet.
- 2
Spread 2 tbsp pizza sauce evenly over each pita.
- 3
Top each with 1/2 cup mozzarella cheese.
- 4
Broil 4 inches from heat until cheese melts and bubbles, 2–3 minutes.
- 5
Serve hot straight from the oven.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
