CookSnap is coming soon — Join the waitlist →
Back to recipes

Pickle Pizza

Tangy, crispy pizza topped with dill pickles, caramelized onions, and melted cheese. A bold, briny take on an American classic.

Total time
35 min
Servings
2
Calories
620
Protein
22g
Pickle Pizza
casualcomfortamericanvegetariancrispymeltyweeknightcasual

Ingredients

  • 1 ball store-bought pizza dough (1 lb)
  • 1 medium yellow onion
  • 1 cup dill pickle chips (drained)
  • 2 cups whole milk mozzarella cheese, shredded
  • 3 tbsp cream cheese
  • 2 tbsp fresh dill
  • 3 tbsp olive oil
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Preheat oven to 475°F. Slice onion into thin half-moons.

  2. 2

    Heat 2 tbsp olive oil in a skillet over medium. Add onions and cook, stirring occasionally, until golden and soft, 12–15 minutes.

  3. 3

    Drain pickles well in a colander, pressing gently to remove excess brine.

  4. 4

    Stretch pizza dough into a round on a parchment-lined baking sheet, about 12 inches across.

  5. 5

    Brush dough lightly with 1 tbsp olive oil. Season with salt and pepper.

  6. 6

    Spread cream cheese evenly over the dough as a base layer.

  7. 7

    Scatter caramelized onions over the cream cheese, then add drained pickles.

  8. 8

    Top with shredded mozzarella, covering the entire surface.

  9. 9

    Bake until crust is golden and cheese bubbles at edges, 10–12 minutes.

  10. 10

    Scatter fresh dill over hot pizza. Slice and serve immediately.

Tools you’ll need

  • medium skillet
  • colander
  • baking sheet
  • parchment paper
  • oven
  • large spoon or spatula
  • pizza cutter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.