5-Minute Pizza Toast Bites
Crispy bread slices loaded with marinara, melted cheese, and pepperoni in under 5 minutes. No oven needed — just a toaster and a skillet for maximum crunch.
- Total time
- 5 min
- Servings
- 2
- Calories
- 420
- Protein
- 18g
casualquickitalianvegetariancheesecrispymeltysnack
Ingredients
- 4 slices bread slices (thick-cut, Italian or sourdough)
- ½ cup marinara sauce
- 1 cup mozzarella cheese, shredded
- ½ cup pepperoni slices
- 1 tbsp olive oil
Instructions
- 1
Toast bread slices until golden and crispy, about 2 minutes.
- 2
Spread 2 tbsp marinara on each toast slice, then top with mozzarella and pepperoni.
- 3
Heat olive oil in a skillet over medium heat until shimmering, about 45 seconds.
- 4
Pan-fry toasts cheese-side up until bottoms are golden and cheese starts to melt, ~2 minutes.
- 5
Serve immediately while cheese is still melty and edges are crispy.
Tools you’ll need
- toaster
- 10-inch skillet
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
