Crispy Mozzarella Pizza Toast Bites
Soft bread topped with pizza sauce, melty mozzarella, and pepperoni, broiled until the cheese bubbles and edges crisp. Ready in 8 minutes—the perfect snack that actually tastes like pizza.
- Total time
- 8 min
- Servings
- 2
- Calories
- 286
- Protein
- 14g
casualquickitalianvegetariancheesecrispymeltygooey
Ingredients
- 1 loaf, cut into 1/2-inch slices (about 8 slices) Italian bread or baguette
- ½ cup pizza sauce or marinara
- 8 oz, sliced or torn into small pieces fresh mozzarella
- 2 oz, about 20 slices pepperoni slices (optional)
- 2 cloves, minced garlic
- 1 tsp dried oregano
Instructions
- 1
Arrange bread slices on a sheet pan or baking sheet in a single layer.
- 2
Spread about 1 tbsp pizza sauce on each slice, leaving a 1/4-inch border.
- 3
Top each slice with mozzarella, pepperoni (if using), and a pinch of minced garlic and oregano.
- 4
Broil on the highest rack for 3–4 minutes, watching closely, until cheese melts and edges turn golden.
- 5
Remove and let cool 1 minute before serving—the cheese will still be gooey.
Tools you’ll need
- sheet pan or baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
