Crispy Cheese & Tomato Pizza Toast Bites
Golden-brown toast rounds loaded with melted mozzarella, tangy tomato sauce, and a scatter of fresh basil. Ready in 12 minutes — the ultimate 4 PM snack.
- Total time
- 12 min
- Servings
- 2
- Calories
- 285
- Protein
- 12g
quickcasualitalianvegetariancheesecrispymeltysnack
Ingredients
- 8 slices bread, sliced (sourdough or ciabatta)
- ½ cup tomato sauce (jarred or fresh)
- 1 cup mozzarella cheese, shredded
- 2 tbsp fresh basil, chopped
- 1 tbsp olive oil
Instructions
- 1
Preheat broiler on high. Arrange bread slices on a sheet pan in a single layer.
- 2
Brush each slice lightly with olive oil. Broil 2 minutes until edges turn golden and crisp.
- 3
Remove pan from broiler. Spread 1 tbsp tomato sauce on each slice.
- 4
Top each with a handful of mozzarella. Return to broiler for 2–3 minutes until cheese melts and bubbles.
- 5
Scatter fresh basil on top. Serve immediately while cheese is still gooey.
Tools you’ll need
- sheet pan
- broiler or toaster oven
- pastry brush
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
