Crispy Pizza Toast Bites
Toasted bread topped with melty mozzarella, pepperoni, and marinara — ready in under 10 minutes. Perfect grab-and-go snack that tastes like pizza without the oven wait.
- Total time
- 8 min
- Servings
- 2
- Calories
- 285
- Protein
- 11g
casualquickitalianvegetariancheesecrispymeltysnack
Ingredients
- 4 slices bread (white, sourdough, or Italian), sliced 1/2-inch thick
- ¾ cup mozzarella cheese, shredded
- ⅓ cup marinara sauce
- 8 slices pepperoni slices
- 1 tbsp olive oil
Instructions
- 1
Brush both sides of bread slices lightly with olive oil and arrange on a broiler tray in a single layer.
- 2
Broil bread 2 minutes, watching closely until edges are golden and surfaces are crispy.
- 3
Spread 1 tbsp marinara on each slice, then top with mozzarella and 2 pepperoni slices per toast.
- 4
Return to broiler for 2 minutes until cheese is melted and edges bubble.
- 5
Let cool 1 minute so cheese sets slightly, then serve hot.
Tools you’ll need
- broiler tray or baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
