CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Minute Pancit Canton

Crispy egg noodles tossed with garlic, soy, and fresh veggies in one hot skillet. The Filipino street-food classic that cooks faster than takeout.

Total time
15 min
Servings
2
Calories
380
Protein
10g
15-Minute Pancit Canton
quicksatisfyingfilipinovegetarianvegetariancrispychewyweeknight

Ingredients

  • 8 oz cantonese-style egg noodles (or ramen)
  • 3 cloves garlic, minced
  • 3 tbsp soy sauce
  • 2 cups mixed vegetables (carrots, cabbage, green onion, bell pepper)
  • 2 tbsp neutral oil
  • ¼ tsp white pepper

Instructions

  1. 1

    Boil noodles in salted water until just tender, about 4 minutes. Drain well and set aside.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  3. 3

    Add garlic and cook, stirring constantly, until fragrant, about 30 seconds.

  4. 4

    Toss in the vegetables and stir-fry for 2 minutes until they begin to soften.

  5. 5

    Add the noodles and soy sauce, tossing constantly until noodles are coated and edges turn crispy and golden, about 2 minutes.

  6. 6

    Finish with white pepper, toss once more, and serve immediately while hot.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling
  • wooden spoon or spatula
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Filipino recipes →