CookSnap is coming soon — Join the waitlist →
Back to recipes

Vegetable Stir-Fry Noodles

Fast, wok-style noodles loaded with crisp vegetables and a glossy soy-ginger sauce. Perfect weeknight dinner that comes together in 25 minutes.

Total time
25 min
Servings
4
Calories
378
Protein
10g
Vegetable Stir-Fry Noodles
quicksatisfyingasianvegetarianvegancrispytenderchewy

Ingredients

  • 12 oz dried egg noodles or ramen
  • 3 tbsp peanut or vegetable oil
  • 4 cloves garlic cloves, minced
  • 1 tbsp fresh ginger, minced
  • 2 medium bell pepper, sliced into strips
  • 2 cups snap peas
  • 1.5 cups carrots, sliced thin
  • 3 tbsp low-sodium soy sauce
  • 1 tbsp rice vinegar
  • 1 tbsp sesame oil
  • 3 tbsp scallions, chopped

Instructions

  1. 1

    Boil noodles in salted water until tender, ~5 minutes. Drain and set aside.

  2. 2

    In a small bowl, whisk together soy sauce, rice vinegar, and sesame oil.

  3. 3

    Heat oil in a 12-inch skillet or wok over high heat until it just shimmers, ~60 seconds.

  4. 4

    Add garlic and ginger, stirring constantly until fragrant, ~30 seconds.

  5. 5

    Add bell pepper, snap peas, and carrots. Stir constantly for 3-4 minutes until vegetables are bright and crisp-tender.

  6. 6

    Pour in the sauce and add the cooked noodles. Toss constantly until everything is coated and heated through, ~2 minutes.

  7. 7

    Scatter scallions over the top and serve immediately while steam rises from the noodles.

Tools you’ll need

  • large pot or kettle
  • 12-inch skillet or wok
  • small mixing bowl
  • whisk
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.