Custrd is out on the App Store — Download it free →
Back to recipes

10-Min Pineapple Fried Rice

Cooked rice tossed with fresh pineapple, soy sauce, and cashews in a hot skillet — crispy, sweet, and ready in 10 minutes. A vegetarian Thai-style bowl that tastes like takeout.

Total time
10 min
Servings
2
Calories
358
Protein
7g
10-Min Pineapple Fried Rice
freshquickthaivegetarianvegancrispytenderweeknight

Ingredients

  • 2 cups cooked jasmine rice, chilled
  • 1 cup fresh pineapple, cut into 0.5-inch chunks
  • 2 tbsp soy sauce
  • ½ cup roasted cashews, chopped
  • 3 stalks green onion, sliced into 1-inch pieces
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.

  2. 2

    Add the chilled rice, breaking up clumps with a wooden spoon. Toss constantly for 2 minutes until the rice is heated through.

  3. 3

    Pour in soy sauce and toss to coat evenly. Add pineapple chunks and cashews, stirring for 1 minute until fragrant.

  4. 4

    Fold in green onions and remove from heat. Serve immediately while hot.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.