10-Min Pineapple Fried Rice
Cooked rice tossed with fresh pineapple, soy sauce, and cashews in a hot skillet — crispy, sweet, and ready in 10 minutes. A vegetarian Thai-style bowl that tastes like takeout.
- Total time
- 10 min
- Servings
- 2
- Calories
- 358
- Protein
- 7g

freshquickthaivegetarianvegancrispytenderweeknight
Ingredients
- 2 cups cooked jasmine rice, chilled
- 1 cup fresh pineapple, cut into 0.5-inch chunks
- 2 tbsp soy sauce
- ½ cup roasted cashews, chopped
- 3 stalks green onion, sliced into 1-inch pieces
- 2 tbsp neutral cooking oil
Instructions
- 1
Heat oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.
- 2
Add the chilled rice, breaking up clumps with a wooden spoon. Toss constantly for 2 minutes until the rice is heated through.
- 3
Pour in soy sauce and toss to coat evenly. Add pineapple chunks and cashews, stirring for 1 minute until fragrant.
- 4
Fold in green onions and remove from heat. Serve immediately while hot.
Tools you’ll need
- 12-inch skillet
- wooden spoon
- cutting board
- sharp knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
More recipes like this
Craving more? Browse all Thai recipes →



