CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Yucatán Pork with Roasted Potatoes

Quick-seared pork shoulder cubes with warm spices, roasted potatoes, and sautéed vegetables in one sheet pan. A stripped-down weeknight take on lomitos de Valladolid that skips the long simmer.

Total time
20 min
Servings
4
Calories
420
Protein
42g
20-Min Yucatán Pork with Roasted Potatoes
comfortsatisfyingmexicanporktendercrispyweeknightmain-dish

Ingredients

  • 1.5 lbs pork shoulder, cut into 1-inch cubes
  • 1 lb small potatoes, halved
  • 1 large bell pepper, cut into 1-inch chunks
  • 1 cup cherry tomatoes
  • 1.5 tsp combined cumin and dried oregano (Mexican blend)
  • 3 tbsp olive oil

Instructions

  1. 1

    Pat pork dry. Toss pork, potatoes, bell pepper, and tomatoes with oil, cumin, oregano, salt, and pepper.

  2. 2

    Spread in a single layer on a sheet pan. Roast at 425°F for 18–20 minutes until pork is cooked through.

  3. 3

    Check pork internal temp reaches 160°F. Potatoes and tomatoes should be tender with charred edges.

  4. 4

    Divide onto plates. Squeeze fresh lime and serve warm.

Tools you’ll need

  • sheet pan (18x13 inch)
  • oven
  • instant-read meat thermometer
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.