CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Mole Amarillo Chicken Empanadas

Crispy, golden empanada wrappers stuffed with shredded rotisserie chicken and earthy yellow mole sauce, finished on a sheet pan in 25 minutes. One-pan, zero-fuss weeknight dinner that tastes like a taquería.

Total time
25 min
Servings
4
Calories
445
Protein
24g
Sheet-Pan Mole Amarillo Chicken Empanadas
comfortsatisfyingmexicanchickencrispyflakytenderweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • ¾ cup mole amarillo paste (jarred)
  • 12 count empanada dough discs (frozen, thawed)
  • ½ cup queso fresco, crumbled
  • ½ cup diced poblano pepper
  • 1 count egg
  • 2 tbsp olive oil
  • 3 tbsp cilantro, chopped

Instructions

  1. 1

    Toss shredded chicken with mole paste and diced poblano until coated; stir in cilantro and queso fresco.

  2. 2

    Place 2 tbsp filling on each empanada disc, fold in half, and crimp edges with a fork to seal.

  3. 3

    Beat egg with 1 tbsp water. Brush both sides of each empanada with egg wash.

  4. 4

    Arrange empanadas on a sheet pan lined with parchment, drizzle with olive oil, and bake at 400°F for 18–20 minutes until deep golden.

  5. 5

    Let cool 2 minutes, then serve hot with extra mole on the side if desired.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • fork
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.