CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Minute Xinjiang Beef with Cumin & Chili

Tender beef strips wok-seared with celery and bell peppers, finished with toasted cumin and chili flakes for that signature Xinjiang heat and aroma. Serve over noodles or rice for a complete weeknight dinner.

Total time
25 min
Servings
2
Calories
420
Protein
38g
25-Minute Xinjiang Beef with Cumin & Chili
quicksatisfyingchinesebeefcrispytenderweeknightstir-fry

Ingredients

  • ¾ lb beef flank steak, thinly sliced against the grain
  • 2 stalks celery stalks, cut into 2-inch pieces
  • 2 medium bell peppers (red or yellow), cut into 1-inch chunks
  • 1.5 tbsp cumin seeds
  • ¾ tsp chili flakes
  • 2 tbsp soy sauce
  • 3 tbsp neutral cooking oil
  • 3 cloves garlic cloves, minced

Instructions

  1. 1

    Toast cumin seeds in a wok or large skillet over medium heat for 1 minute until fragrant, then transfer to a small bowl.

  2. 2

    Increase heat to high. Add 2 tbsp oil to the wok until it shimmers, about 30 seconds.

  3. 3

    Add beef in a single layer without stirring for 1 minute until the bottom caramelizes, then stir and cook until no pink remains, ~2 minutes total.

  4. 4

    Push beef to the side. Add remaining oil, then garlic, and stir for 20 seconds until fragrant.

  5. 5

    Add celery and peppers, tossing constantly for 2–3 minutes until vegetables are tender-crisp with charred edges.

  6. 6

    Pour in soy sauce, sprinkle the toasted cumin and chili flakes over everything, toss for 30 seconds, then serve immediately.

Tools you’ll need

  • 14-inch wok or large skillet
  • small bowl
  • tongs or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.