CookSnap is coming soon — Join the waitlist →

Thai Beef Stir-Fry

Tender beef cooked with bell peppers and onions in a savory-spicy Thai sauce. Ready in under 20 minutes and served over rice.

Total time
18 min
Servings
2
Calories
380
Protein
38g
Thai Beef Stir-Fry
quicksatisfyingthaibeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or flank steak
  • 2 medium red or yellow bell peppers
  • 1 medium yellow onion
  • 3 tbsp soy sauce
  • 1 tbsp fish sauce
  • 1 tbsp Thai chili paste (such as sriracha or sambal oelek)

Instructions

  1. 1

    Place the beef on a cutting board, then slice it against the grain into strips about 1/4-inch thick. Imagine cutting across the muscle fibers, not parallel to them.

  2. 2

    Place each bell pepper stem-side down on the cutting board, then slice straight down from top to bottom into 1/4-inch-thick strips about 2 inches long.

  3. 3

    Place the onion stem-side up, then slice it in half lengthwise from root to tip. Lay each half flat and slice it crosswise into 1/4-inch-thick half-rings.

  4. 4

    Pour the soy sauce, fish sauce, and Thai chili paste into a small bowl and stir with a spoon until the paste is fully blended into the liquid, about 30 seconds.

  5. 5

    Heat 2 tablespoons of oil in a 12-inch skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 90 seconds.

  6. 6

    Add the beef strips to the skillet in a single layer and let them sit undisturbed for 60 seconds, until the bottom surface looks deeply browned.

  7. 7

    Stir the beef with a wooden spoon or spatula, breaking apart any pieces that stick together, and cook for another 60 seconds until the beef is cooked through. Transfer it to a clean plate.

  8. 8

    Add 1 more tablespoon of oil to the same skillet over medium-high heat. Once it shimmers, add the onion slices and cook, stirring every 30 seconds, until the edges begin to look translucent, about 2 minutes.

  9. 9

    Add the bell pepper strips to the skillet with the onions and stir gently with a wooden spoon every 30 seconds until the peppers soften slightly and the edges just begin to look slightly darker, about 2 minutes.

  10. 10

    Pour the sauce into the skillet and use a wooden spoon to stir the vegetables continuously for 30 seconds until they are completely coated and the sauce looks glossy.

  11. 11

    Return the cooked beef to the skillet and stir everything together with a wooden spoon for 30 seconds until the beef is heated through and the sauce clings to the beef and vegetables.

  12. 12

    Divide the stir-fry between two serving bowls or plates. Pour any remaining sauce from the skillet over the top of each portion.

Tools you’ll need

  • cutting board
  • chef's knife
  • small bowl
  • spoon
  • 12-inch skillet
  • wooden spoon or spatula
  • clean plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.