Warm Feta with Honey & Cracked Pepper
Creamy baked feta with a golden honey drizzle and sharp black pepper bite — a Greek appetizer that feels fancy but takes 10 minutes. Serve with crusty bread or crackers for dipping.
- Total time
- 10 min
- Servings
- 2
- Calories
- 280
- Protein
- 6g
elegantsimplegreekvegetariancreamysoftsnackappetizer
Ingredients
- 8 oz feta cheese block
- 3 tbsp honey
- 2 tbsp olive oil
- ¼ tsp black pepper
Instructions
- 1
Heat oven to 375°F.
- 2
Place feta block in a small baking dish and drizzle with olive oil.
- 3
Bake feta until soft and warm, about 7 minutes.
- 4
Drizzle honey over the feta and sprinkle with black pepper.
- 5
Serve warm with bread or crackers for dipping.
Tools you’ll need
- oven
- small baking dish (6- to 8-inch)
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
