CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Shaking Beef (Com Bo Luc Lac)

Tender beef cubes charred in a hot pan, tossed with garlic, lime, and fish sauce for a bright, savory Vietnamese classic. Served over rice with fresh tomatoes and onions.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Vietnamese Shaking Beef (Com Bo Luc Lac)
casualfreshvietnamesebeeftendercrispyweeknightmain-dish

Ingredients

  • ¾ lb beef sirloin or tenderloin
  • 1.5 cups cooked white rice
  • 4 whole garlic cloves
  • 2 tablespoons fish sauce
  • 1 whole lime
  • ½ teaspoon black pepper
  • 3 tablespoons olive oil

Instructions

  1. 1

    Pat the beef dry with paper towels, pressing firmly on both sides. This removes surface moisture so the meat will brown instead of steam.

  2. 2

    Cut the beef into 1-inch cubes by slicing the meat lengthwise with the grain into strips about 1 inch wide, then cutting each strip crosswise into 1-inch cubes.

  3. 3

    Mince the garlic until the pieces are smaller than a grain of rice—about the size of pencil-tip dots.

  4. 4

    Cut the lime in half lengthwise. Squeeze one half firmly over a small bowl to collect the juice—you should have about 2 tablespoons.

  5. 5

    In a small bowl, stir the fish sauce, lime juice, and black pepper together until blended. Set aside on the counter.

  6. 6

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 2 minutes.

  7. 7

    Add half the beef cubes in a single layer—do not stir immediately. Let them sit undisturbed for 2 minutes until the bottoms brown deeply, then flip and cook another minute, until browned on the second side. Transfer to a plate.

  8. 8

    Add the remaining 1 tablespoon of olive oil to the hot skillet, then add the remaining beef cubes and cook the same way—2 minutes without stirring, then 1 minute after flipping. Transfer to the plate with the first batch.

  9. 9

    Reduce heat to medium and add the minced garlic to the same skillet. Stir constantly for 30 seconds until it smells deeply fragrant and turns light golden.

  10. 10

    Pour the fish sauce mixture into the skillet and scrape the bottom with a wooden spoon to loosen any stuck-on brown bits. Stir for 15 seconds.

  11. 11

    Return all the beef cubes to the skillet. Using tongs or two wooden spoons, toss everything together for 30 seconds so the beef coats evenly with the sauce.

  12. 12

    Divide the rice between two bowls or plates, making a mound at the center of each.

  13. 13

    Spoon the beef and sauce on top of the rice, dividing evenly between the two bowls.

  14. 14

    Cut the remaining lime half into two wedges and place one wedge on the side of each bowl, for squeezing over the beef at the table.

Tools you’ll need

  • cutting board
  • sharp knife
  • paper towels
  • small bowl
  • 12-inch skillet
  • wooden spoon
  • tongs or two wooden spoons
  • two serving bowls or plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.