CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fried Fish with Noodle Bowl

Whole fish seasoned and pan-fried until golden, served over cool vermicelli with lettuce, herbs, and a tangy-sweet dipping sauce. Restaurant-quality Vietnamese street food in under 25 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
42g
Crispy Fried Fish with Noodle Bowl
freshcasualvietnamesefishcrispytenderweeknightdinner

Ingredients

  • 2 fish (about 1 lb total) whole fish (sea bass, branzino, or snapper), cleaned and scaled
  • 3 tbsp fish sauce
  • 1 whole lime (juiced)
  • 1 tbsp granulated sugar
  • 6 oz dried rice vermicelli noodles
  • 2 cups fresh lettuce leaves (butter or romaine)
  • ½ cup fresh herbs (cilantro, mint, or Thai basil), chopped
  • 3 tbsp neutral cooking oil

Instructions

  1. 1

    Make dipping sauce: stir fish sauce, lime juice, sugar, and 3 tbsp water in a bowl until sugar dissolves.

  2. 2

    Boil vermicelli in salted water until tender, about 6 minutes. Drain and rinse with cold water; set aside.

  3. 3

    Pat fish completely dry. Season inside and out with salt and black pepper. Score skin diagonally 3 times on each side.

  4. 4

    Heat oil in a large skillet over medium-high heat until it shimmers. Lay fish skin-side down; cook 5 minutes without moving.

  5. 5

    Flip fish and cook 4 minutes until flesh is opaque when flaked at the thickest part. Skin should be deep golden brown.

  6. 6

    Divide noodles, lettuce, and herbs between bowls. Top with crispy fish and drizzle with dipping sauce.

Tools you’ll need

  • large skillet (12-inch or larger)
  • small bowl for sauce
  • pot for boiling noodles
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.