CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Chicken with Garlic Fish Sauce

Fried chicken thighs glazed in a punchy garlic-fish sauce reduction with crispy edges and tender meat. Serve over rice with scallions and lime — the TikTok version of cơm gà chiên.

Total time
28 min
Servings
2
Calories
385
Protein
38g
Crispy Chicken with Garlic Fish Sauce
comfortcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

  • 4 pieces chicken thighs, skin-on and bone-in
  • 3 tbsp fish sauce
  • 6 cloves garlic, minced
  • 1 whole lime
  • 3 pieces scallions, chopped
  • 1 tbsp white sugar
  • ¼ cup chicken broth

Instructions

  1. 1

    Pat chicken thighs dry and season generously with salt and black pepper on both sides.

  2. 2

    Heat oil in a 12-inch skillet over medium-high until shimmering. Place chicken skin-side down and sear without moving for 6 minutes until skin is golden and crispy.

  3. 3

    Flip chicken and sear the other side for 4 minutes until cooked through. Transfer to a plate.

  4. 4

    Pour off excess fat, leaving 1 tbsp. Add garlic and cook 30 seconds until fragrant, then add fish sauce, sugar, and broth.

  5. 5

    Return chicken to the skillet and turn to coat in glaze. Simmer for 2 minutes until sauce thickens and clings to the chicken.

  6. 6

    Squeeze lime juice over the top and garnish with scallions. Serve immediately over rice.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • paper towels
  • measuring spoons
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.