Triple Cheese Penne
Creamy, melty pasta with three cheeses stirred into hot penne—no sauce simmering, just cheese melting into pasta water for instant richness. Ready in under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 520
- Protein
- 22g
comfortsimpleitalianvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz penne pasta
- ¾ cup mozzarella cheese, shredded
- ½ cup parmesan cheese, grated
- ½ cup cheddar cheese, shredded
Instructions
- 1
Boil penne in salted water until al dente, about 9 minutes.
- 2
Reserve 1 cup pasta water, then drain the pasta.
- 3
Return pasta to the warm pot off heat.
- 4
Add all three cheeses and stir until melted and creamy, about 2 minutes.
- 5
Add pasta water 1/4 cup at a time until the sauce coats the pasta.
- 6
Season with salt and pepper, then serve immediately.
Tools you’ll need
- large pot
- colander
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
