CookSnap is coming soon — Join the waitlist →
Back to recipes

Torched Lemon Curd Tart with Meringue

No-bake lemon curd in a buttery graham crust, topped with torched Italian meringue. Tangy, sweet, and Instagram-worthy in under 30 minutes.

Total time
25 min
Servings
6
Calories
385
Protein
4g
Torched Lemon Curd Tart with Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

  • 1.5 cups graham cracker crumbs
  • 4 tbsp butter, melted
  • 1 cup lemon curd (jarred)
  • ½ cup heavy cream
  • 3 large egg whites
  • 6 tbsp granulated sugar

Instructions

  1. 1

    Mix graham cracker crumbs with melted butter. Press firmly into the bottom and sides of a 9-inch tart pan.

  2. 2

    Whip heavy cream to soft peaks. Fold in lemon curd until fully combined and no streaks remain.

  3. 3

    Pour lemon-cream filling into crust. Chill while you make the meringue, about 5 minutes.

  4. 4

    Add egg whites and sugar to a heatproof bowl over simmering water, whisking constantly until sugar dissolves and mixture reaches 160°F, about 6 minutes.

  5. 5

    Remove from heat. Beat with an electric mixer until stiff, glossy peaks form, about 4 minutes.

  6. 6

    Spread or pipe meringue thickly over filling. Use a kitchen torch to toast peaks golden brown until they blister.

  7. 7

    Serve immediately or chill up to 2 hours before torching.

Tools you’ll need

  • 9-inch tart pan
  • heatproof bowl
  • whisk
  • electric mixer
  • kitchen torch
  • rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →