Custrd is out on the App Store — Download it free →
Back to recipes

Torched Lemon Curd Tart with Meringue

No-bake lemon curd in a buttery graham crust, topped with torched Italian meringue. Tangy, sweet, and Instagram-worthy in under 30 minutes.

Total time
25 min
Servings
6
Calories
385
Protein
4g
Torched Lemon Curd Tart with Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter. Press firmly into the bottom and sides of a 9-inch tart pan.

  2. Step 2

    Whip heavy cream to soft peaks. Fold in lemon curd until fully combined and no streaks remain.

  3. Step 3

    Pour lemon-cream filling into crust. Chill while you make the meringue, about 5 minutes.

  4. Step 4

    Add egg whites and sugar to a heatproof bowl over simmering water, whisking constantly until sugar dissolves and mixture reaches 160°F, about 6 minutes.

  5. Step 5

    Remove from heat. Beat with an electric mixer until stiff, glossy peaks form, about 4 minutes.

  6. Step 6

    Spread or pipe meringue thickly over filling. Use a kitchen torch to toast peaks golden brown until they blister.

  7. Step 7

    Serve immediately or chill up to 2 hours before torching.

Tools you’ll need

  • 9-inch tart pan
  • heatproof bowl
  • whisk
  • electric mixer
  • kitchen torch
  • rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.