CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Minute Lemon Curd Tart with Torched Meringue

No-bake lemon tart with glossy store-bought curd, crispy phyllo crust, and torched Italian meringue. Whipped cream on the side for serving.

Total time
15 min
Servings
4
Calories
285
Protein
4g
15-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispysilkycreamyfluffy

Ingredients

  • 4 sheets Phyllo dough sheets
  • 3 tbsp Butter, melted
  • ¾ cup Lemon curd (store-bought)
  • 2 large Egg whites
  • ¼ cup Granulated sugar
  • ¼ tsp Cream of tartar
  • ½ cup Whipped cream (for serving)

Instructions

  1. 1

    Layer phyllo sheets on a tart pan, brushing each with melted butter. Bake at 375°F for 5 minutes until golden and crisp.

  2. 2

    Pour lemon curd into the cooled phyllo crust, spreading smooth. Chill while you make the meringue.

  3. 3

    Whisk egg whites with cream of tartar until foamy, about 30 seconds. Gradually add sugar, whisking until stiff peaks form.

  4. 4

    Spoon meringue onto the lemon curd filling, creating peaks and swirls.

  5. 5

    Use a kitchen torch to toast the meringue peaks until golden brown and charred in spots, 30-60 seconds.

  6. 6

    Serve immediately with a dollop of whipped cream on the side.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • pastry brush
  • kitchen torch
  • whisk
  • electric mixer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →