CookSnap is coming soon — Join the waitlist →
Back to recipes

30-Minute Lemon Curd Tart with Torched Meringue

Glossy lemon curd meets crispy-chewy meringue in a no-bake tart that looks restaurant-worthy but comes together in under 30 minutes. A viral-worthy dessert with minimal technique.

Total time
30 min
Servings
4
Calories
385
Protein
3g
30-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispycreamygooeyDessert

Ingredients

  • 1.5 cups graham cracker crumbs
  • 4 tbsp butter, melted
  • 1 cup lemon curd, jarred
  • ½ cup heavy cream
  • 3 large egg whites
  • 6 tbsp granulated sugar
  • ½ tsp vanilla extract

Instructions

  1. 1

    Mix graham cracker crumbs with melted butter until evenly moistened.

  2. 2

    Press mixture firmly into a 9-inch tart pan or pie dish, covering bottom and sides.

  3. 3

    Freeze while you prepare the filling, ~5 minutes.

  4. 4

    Whip heavy cream to stiff peaks in a separate bowl using an electric mixer, ~3 minutes.

  5. 5

    Fold lemon curd gently into whipped cream until no streaks remain.

  6. 6

    Pour lemon filling into the frozen crust, smooth the top, and chill while making meringue.

  7. 7

    Beat egg whites and sugar on high speed until stiff, glossy peaks form, ~4 minutes.

  8. 8

    Add vanilla, beat for 15 seconds to combine.

  9. 9

    Spoon meringue onto lemon filling, peak it dramatically, and torch until golden brown.

  10. 10

    Serve immediately while meringue is still warm and crispy outside.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • electric mixer or whisk
  • two medium bowls
  • spatula
  • kitchen torch

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →