Custrd is out on the App Store — Download it free →
Back to recipes

30-Minute Lemon Curd Tart with Torched Meringue

Glossy lemon curd meets crispy-chewy meringue in a no-bake tart that looks restaurant-worthy but comes together in under 30 minutes. A viral-worthy dessert with minimal technique.

Total time
30 min
Servings
4
Calories
385
Protein
3g
30-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispycreamygooeyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter until evenly moistened.

  2. Step 2

    Press mixture firmly into a 9-inch tart pan or pie dish, covering bottom and sides.

  3. Step 3

    Freeze while you prepare the filling, ~5 minutes.

  4. Step 4

    Whip heavy cream to stiff peaks in a separate bowl using an electric mixer, ~3 minutes.

  5. Step 5

    Fold lemon curd gently into whipped cream until no streaks remain.

  6. Step 6

    Pour lemon filling into the frozen crust, smooth the top, and chill while making meringue.

  7. Step 7

    Beat egg whites and sugar on high speed until stiff, glossy peaks form, ~4 minutes.

  8. Step 8

    Add vanilla, beat for 15 seconds to combine.

  9. Step 9

    Spoon meringue onto lemon filling, peak it dramatically, and torch until golden brown.

  10. Step 10

    Serve immediately while meringue is still warm and crispy outside.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • electric mixer or whisk
  • two medium bowls
  • spatula
  • kitchen torch

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.