Custrd is out on the App Store — Download it free →
Back to recipes

5-Minute Lemon Curd Tart with Torched Meringue

Buttery store-bought tart shell meets silky lemon curd, crowned with a caramelized meringue you torch until glossy and browned. Looks restaurant-worthy, tastes tangy-sweet, and comes together in 5 minutes.

Total time
5 min
Servings
4
Calories
240
Protein
3g
5-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spoon lemon curd into the tart shell and spread evenly to the edges.

  2. Step 2

    Whip egg whites with cream of tartar until foamy, ~30 seconds.

  3. Step 3

    Sprinkle sugar in slowly while whisking until stiff, glossy peaks form, ~2 minutes.

  4. Step 4

    Pile meringue on top of the lemon curd in peaks and swirls.

  5. Step 5

    Torch the meringue until golden brown and caramelized, ~30 seconds total, moving flame constantly.

  6. Step 6

    Sprinkle lemon zest over the top and serve immediately.

Tools you’ll need

  • hand mixer or whisk
  • kitchen torch
  • 9-inch or smaller tart pan (pre-baked shell)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.