15-Min No-Bake Lemon Curd Tart
Glossy lemon curd in a buttery graham cracker crust, topped with torched meringue. Ready in 15 minutes — no oven required, just a kitchen torch.
- Total time
- 15 min
- Servings
- 6
- Calories
- 285
- Protein
- 3g

elegantindulgentfrenchvegetariancreamycrispyfluffyDessert
Ingredients
- 1.5 cups graham cracker crumbs
- 4 tbsp butter, melted
- 1 cup lemon curd (jarred)
- 2 large egg whites, room temperature
- ¼ cup granulated sugar
- ⅛ tsp cream of tartar
- 1 tsp lemon zest (optional garnish)
Instructions
- 1
Mix graham cracker crumbs with melted butter until resembles wet sand.
- 2
Press firmly into a 9-inch tart pan or pie dish, creating an even layer.
- 3
Spread lemon curd in an even layer across the crust.
- 4
Whip egg whites with cream of tartar until soft peaks form, about 2 minutes.
- 5
Add sugar 1 tbsp at a time while whisking until stiff, glossy peaks form.
- 6
Dollop meringue onto lemon curd, spreading to edges. Torch the peaks until golden brown.
Tools you’ll need
- 9-inch tart pan or pie dish
- mixing bowl
- whisk or electric mixer
- kitchen torch
- spatula or back of spoon
- measuring cups and spoons
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.


