Custrd is out on the App Store — Download it free →
Back to recipes

15-Min No-Bake Lemon Curd Tart

Glossy lemon curd in a buttery graham cracker crust, topped with torched meringue. Ready in 15 minutes — no oven required, just a kitchen torch.

Total time
15 min
Servings
6
Calories
285
Protein
3g
15-Min No-Bake Lemon Curd Tart
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

  • 1.5 cups graham cracker crumbs
  • 4 tbsp butter, melted
  • 1 cup lemon curd (jarred)
  • 2 large egg whites, room temperature
  • ¼ cup granulated sugar
  • ⅛ tsp cream of tartar
  • 1 tsp lemon zest (optional garnish)

Instructions

  1. 1

    Mix graham cracker crumbs with melted butter until resembles wet sand.

  2. 2

    Press firmly into a 9-inch tart pan or pie dish, creating an even layer.

  3. 3

    Spread lemon curd in an even layer across the crust.

  4. 4

    Whip egg whites with cream of tartar until soft peaks form, about 2 minutes.

  5. 5

    Add sugar 1 tbsp at a time while whisking until stiff, glossy peaks form.

  6. 6

    Dollop meringue onto lemon curd, spreading to edges. Torch the peaks until golden brown.

Tools you’ll need

  • 9-inch tart pan or pie dish
  • mixing bowl
  • whisk or electric mixer
  • kitchen torch
  • spatula or back of spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.