CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Lemon Curd Tartlets with Torched Meringue

No-bake lemon tarts with glossy store-bought curd, homemade meringue peaks torched golden, and candied lime slices. Looks fancy, tastes restaurant-level, ready in minutes.

Total time
15 min
Servings
4
Calories
285
Protein
4g
15-Min Lemon Curd Tartlets with Torched Meringue
elegantfancylightfrenchvegetariancreamycrispyfluffy

Ingredients

  • 1 jar (10 oz) lemon curd (store-bought)
  • 4 count tartlet shells (pre-baked)
  • 3 count egg whites
  • 6 tbsp granulated sugar
  • ¼ tsp cream of tartar
  • 2 count limes (for garnish)

Instructions

  1. 1

    Spoon lemon curd into each tartlet shell, dividing evenly. Set aside.

  2. 2

    Add egg whites and cream of tartar to a clean bowl. Whip until soft peaks form, ~3 minutes.

  3. 3

    Gradually add sugar while whipping until stiff, glossy peaks form, another ~2 minutes.

  4. 4

    Pipe or dollop meringue onto each tart, creating peaks and swirls.

  5. 5

    Use a kitchen torch to brown the meringue peaks until golden with light char, 10-15 seconds per tart.

  6. 6

    Thinly slice limes and arrange on the plate alongside the tarts. Serve immediately.

Tools you’ll need

  • 4 pre-baked tartlet shells (3-inch)
  • medium mixing bowl
  • electric mixer or whisk
  • kitchen torch
  • piping bag (optional)
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →