Custrd is out on the App Store — Download it free →
Back to recipes

Torched Lemon Curd Tarts with Quick Meringue

Glossy lemon curd in a buttery shell, crowned with torched meringue—no bake required. Four individual tarts in under 25 minutes using store-bought shells and a hand mixer.

Total time
25 min
Servings
4
Calories
310
Protein
4g
Torched Lemon Curd Tarts with Quick Meringue
elegantindulgentfrenchvegetariancrispycreamyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spoon lemon curd evenly into the four tartlet shells until three-quarters full.

  2. Step 2

    Add egg whites and cream of tartar to a clean bowl. Beat with a hand mixer until soft peaks form, ~2 minutes.

  3. Step 3

    Gradually sprinkle in sugar while beating until stiff, glossy peaks form and the meringue looks like marshmallow fluff, ~3 minutes.

  4. Step 4

    Fold vanilla extract into meringue with a spatula, then top each tart with a generous dollop of meringue.

  5. Step 5

    Using a kitchen torch, slowly wave the flame over each meringue peak until lightly browned and blistered, ~30 seconds per tart.

  6. Step 6

    Sprinkle lemon zest over tops and serve immediately while meringue is still crispy and warm.

Tools you’ll need

  • 4 pre-baked tartlet shells
  • medium mixing bowl
  • hand mixer or whisk
  • rubber spatula
  • kitchen torch

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.