CookSnap is coming soon — Join the waitlist →

20-Min Glossy Lemon Curd Tart with Torched Meringue

No-bake lemon tart with shop-bought shortbread base, silky lemon curd, and a quick meringue toasted with a kitchen torch. Served with whipped cream for richness.

Total time
20 min
Servings
6
Calories
385
Protein
4g
20-Min Glossy Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispysilkyfluffydate-night

Ingredients

  • 1 whole shop-bought shortbread tart shell (9-inch), pre-baked
  • 1.25 cup lemon curd (jarred or homemade)
  • 3 whole large egg whites
  • ½ cup granulated sugar
  • ⅛ tsp cream of tartar
  • ½ tsp fresh lemon zest
  • ¾ cup cold heavy cream

Instructions

  1. 1

    Spread lemon curd evenly into the shortbread shell, smoothing the top with a spatula.

  2. 2

    Beat egg whites and cream of tartar on medium-high speed until soft peaks form, ~2 minutes.

  3. 3

    Add sugar 1 tbsp at a time, beating between additions, until stiff glossy peaks form, ~3 minutes total.

  4. 4

    Fold lemon zest into meringue gently with a spatula until just combined.

  5. 5

    Pile meringue onto the tart, using the back of a spoon to create peaks and valleys.

  6. 6

    Use a kitchen torch to toast meringue until golden brown, moving constantly to avoid burning.

  7. 7

    Whip cold heavy cream to soft peaks and serve dolloped alongside each slice while tart cools 5 minutes.

Tools you’ll need

  • 9-inch tart pan with shortbread shell
  • electric mixer or whisk
  • rubber spatula
  • kitchen torch (culinary)
  • serving knife or offset spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.