Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Glossy Lemon Curd Tart with Torched Meringue

No-bake lemon tart with shop-bought shortbread base, silky lemon curd, and a quick meringue toasted with a kitchen torch. Served with whipped cream for richness.

Total time
20 min
Servings
6
Calories
385
Protein
4g
20-Min Glossy Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispysilkyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread lemon curd evenly into the shortbread shell, smoothing the top with a spatula.

  2. Step 2

    Beat egg whites and cream of tartar on medium-high speed until soft peaks form, ~2 minutes.

  3. Step 3

    Add sugar 1 tbsp at a time, beating between additions, until stiff glossy peaks form, ~3 minutes total.

  4. Step 4

    Fold lemon zest into meringue gently with a spatula until just combined.

  5. Step 5

    Pile meringue onto the tart, using the back of a spoon to create peaks and valleys.

  6. Step 6

    Use a kitchen torch to toast meringue until golden brown, moving constantly to avoid burning.

  7. Step 7

    Whip cold heavy cream to soft peaks and serve dolloped alongside each slice while tart cools 5 minutes.

Tools you’ll need

  • 9-inch tart pan with shortbread shell
  • electric mixer or whisk
  • rubber spatula
  • kitchen torch (culinary)
  • serving knife or offset spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.