Tomato Cream Pasta
Silky tomato and cream sauce clings to pasta in under 20 minutes. A weeknight staple that tastes like you spent an hour cooking.
- Total time
- 18 min
- Servings
- 2
- Calories
- 485
- Protein
- 14g
comfortsimpleitalianvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz penne or rigatoni
- 14 oz canned crushed tomatoes
- ½ cup heavy cream
- 2 cloves garlic, minced
- 1 tbsp butter
- 1 pinch salt and black pepper to taste
Instructions
- 1
Boil salted water in a large pot. Add pasta and cook until al dente, ~10 minutes.
- 2
Meanwhile, heat butter in a large skillet over medium. Add garlic and cook until fragrant, ~1 minute.
- 3
Pour in crushed tomatoes and simmer for 4 minutes, stirring occasionally.
- 4
Remove from heat and stir in cream until the sauce is pale pink and silky.
- 5
Drain pasta and add to the skillet. Toss until coated, 1 minute.
- 6
Season with salt and pepper. Serve immediately in shallow bowls.
Tools you’ll need
- large pot
- large skillet or sauté pan
- wooden spoon
- colander
- tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
