CookSnap is coming soon — Join the waitlist →
Back to recipes

Tomato & Bread Salad

Crispy bread cubes tossed with ripe tomatoes, red onion, and a bright vinaigrette—the Tuscan way to use up stale bread. Ready in 15 minutes, tastes like summer.

Total time
15 min
Servings
4
Calories
285
Protein
6g
Tomato & Bread Salad
lightfreshsimpleitalianvegetarianvegancrispytender

Ingredients

  • 8 oz stale or day-old bread (rustic, crusty)
  • 1.25 lb ripe tomatoes (Roma or beefsteak), roughly chopped
  • ½ small red onion, thinly sliced
  • ⅓ cup fresh basil
  • 3 tbsp red wine vinegar
  • 6 tbsp olive oil
  • 1 clove garlic clove, minced

Instructions

  1. 1

    Cut bread into 1-inch cubes. Heat 2 tbsp olive oil in a large skillet over medium-high heat.

  2. 2

    Add bread cubes and cook 4–5 minutes, stirring occasionally, until golden and crispy all over.

  3. 3

    Transfer bread to a large bowl. Whisk together vinegar, remaining 4 tbsp oil, garlic, salt, and pepper.

  4. 4

    Add tomatoes, onion, and basil to the bowl with bread. Pour vinaigrette over and toss gently.

  5. 5

    Let sit for 5 minutes so flavors blend and bread absorbs the dressing, then taste and adjust seasoning.

  6. 6

    Serve at room temperature or chilled.

Tools you’ll need

  • large skillet
  • large bowl
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.