CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Balsamic Pasta Salad with Cherry Tomatoes & Basil

A bright, no-cook salad of peppery arugula, sweet cherry tomatoes, and creamy mozzarella tossed with warm pasta in a punchy balsamic vinaigrette. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
14g
Balsamic Pasta Salad with Cherry Tomatoes & Basil
freshlightsimpleitalianvegetariancheesetendercreamy

Ingredients

  • 8 oz pasta (penne, fusilli, or farfalle)
  • 3 cups fresh arugula
  • 1.5 cups cherry tomatoes
  • 1 cup fresh mozzarella balls (bocconcini)
  • 3 tablespoons balsamic vinegar
  • 3 tablespoons olive oil
  • ¼ cup fresh basil leaves
  • 1 pinch to taste salt and pepper

Instructions

  1. 1

    Bring a large pot of salted water to a rolling boil over high heat — the water should bubble vigorously and steam should rise from the surface, about 8 minutes.

  2. 2

    Add the pasta and stir it once with a wooden spoon to separate the strands; boil until the pasta is tender but still slightly firm when bitten, about 9 minutes or according to package directions.

  3. 3

    Drain the pasta in a colander, then immediately rinse it under cool running water for 15 seconds while tossing with a fork to stop it cooking and cool it down.

  4. 4

    Place each cherry tomato on a cutting board and slice it in half straight down through the middle from top to bottom — you should have two halves per tomato.

  5. 5

    Stack the fresh basil leaves on top of each other, then roll them tightly into a thin cylinder; slice straight across the roll into ribbon-thin strips about the width of a pencil lead.

  6. 6

    Pour the balsamic vinegar and olive oil into a small bowl; whisk them together with a fork for 10 seconds until the mixture looks slightly creamy and uniform, then add a pinch of salt and pepper.

  7. 7

    Transfer the cooled pasta to a large bowl, then pour the balsamic dressing over it and toss everything together with two forks for 20 seconds until the pasta is evenly coated.

  8. 8

    Add the arugula, cherry tomato halves, and mozzarella balls to the pasta, then toss everything together gently for 15 seconds until the leaves are mixed in — do not overmix or the arugula will bruise.

  9. 9

    Top the salad with the basil ribbons, scatter them across the surface, and taste a forkful; add another pinch of salt and pepper if you like.

Tools you’ll need

  • large pot
  • colander
  • cutting board
  • chef's knife
  • small bowl
  • fork
  • large bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.