CookSnap is coming soon — Join the waitlist →
Back to recipes

Thai Crispy Shrimp & Chicken Salad

Crunchy mixed seafood and chicken with a tangy chili-lime dressing and fresh herbs. A restaurant-style Thai salad you can make in under 20 minutes.

Total time
18 min
Servings
2
Calories
248
Protein
38g
Thai Crispy Shrimp & Chicken Salad
freshlightthaigluten-freeshrimpchickencrispytender

Ingredients

  • ½ lb shrimp, peeled and deveined
  • ½ lb chicken breast, diced into bite-sized pieces
  • 1 whole lime (juiced + zested)
  • 1.5 tbsp Thai chili paste (or sriracha)
  • 1 tbsp fish sauce
  • 3 cups mixed greens (lettuce, spinach, cabbage)
  • ½ cup fresh herbs (cilantro, mint, basil)

Instructions

  1. 1

    Pat shrimp and chicken dry with paper towels. Season both with salt and black pepper.

  2. 2

    Heat 1 tbsp oil in a large skillet over high heat until it shimmers, about 90 seconds.

  3. 3

    Add shrimp and cook without stirring until pink and opaque, about 2 minutes per side. Transfer to a plate.

  4. 4

    In the same skillet, add chicken and cook, stirring occasionally, until no pink remains and edges brown, ~5 minutes.

  5. 5

    Whisk lime juice, chili paste, and fish sauce in a small bowl until smooth.

  6. 6

    Toss greens with dressing in a large bowl. Top with shrimp, chicken, and fresh herbs. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small bowl for dressing
  • large salad bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.