Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Shrimp Glass Noodle Salad

Thai yum woon sen with crispy shrimp, tart lime dressing, and tender glass noodles. Ready in 20 minutes — bright, spicy, totally craveable.

Total time
20 min
Servings
2
Calories
285
Protein
28g
Crispy Shrimp Glass Noodle Salad
freshlightthaigluten-freeshrimpcrispytenderchewy

Ingredients

  • 3 oz glass noodles (mung bean)
  • ¾ lb shrimp, peeled and deveined
  • 2 whole lime (juiced)
  • 2 tbsp fish sauce
  • 1 whole red chili (sliced, seeds optional)
  • ¼ cup red onion (thinly sliced)
  • ½ cup fresh cilantro and mint, chopped
  • 3 tbsp roasted peanuts, crushed

Instructions

  1. 1

    Soak glass noodles in hot water for 5 minutes until softened, then drain well.

  2. 2

    Heat 2 tbsp oil in a skillet over medium-high until shimmering. Pat shrimp dry, add to pan in a single layer.

  3. 3

    Cook shrimp without stirring for 2 minutes until pink on one side, then flip and cook 90 seconds more until opaque.

  4. 4

    Whisk lime juice, fish sauce, and 1 tbsp water together in a bowl until combined.

  5. 5

    Toss noodles, cooked shrimp, red onion, chili, cilantro, and mint in a large bowl with the dressing.

  6. 6

    Top with crushed peanuts and serve immediately.

Tools you’ll need

  • medium mixing bowl
  • 12-inch skillet
  • wooden spoon
  • whisk
  • large serving bowl
  • kitchen knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.