CookSnap is coming soon — Join the waitlist →

Tacos de Nopal con Queso

Tender cactus paddles charred until smoky, topped with melted cheese and fresh toppings. A vegetarian Mexican classic that's ready in 15 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
11g
Tacos de Nopal con Queso
casualfreshmexicanvegetariancheesetendercrispyweeknight

Ingredients

  • 1 lb nopales (cactus paddles), cleaned
  • 8 count corn tortillas
  • ¾ cup queso fresco or cotija cheese, crumbled
  • ½ count white onion, thinly sliced
  • ¼ cup fresh cilantro, chopped
  • 1 count lime, cut into wedges
  • 2 tbsp olive oil

Instructions

  1. 1

    Trim the flat sides of each nopal with a knife, removing the spine bumps and edges.

  2. 2

    Pat the nopales dry with paper towels. Season generously with salt and pepper.

  3. 3

    Warm tortillas in a dry skillet over medium heat, 30 seconds per side. Transfer to a plate.

  4. 4

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  5. 5

    Working in batches, sear the nopales 3-4 minutes per side until charred and tender.

  6. 6

    Remove nopales to a cutting board. Slice into strips once cooled slightly.

  7. 7

    Lay a tortilla flat. Add a handful of nopal strips, top with queso fresco and onion.

  8. 8

    Fold the tortilla in half. Sprinkle cilantro on top. Squeeze lime over the taco.

  9. 9

    Repeat with remaining tortillas and fillings. Serve immediately.

Tools you’ll need

  • chef's knife
  • paper towels
  • large skillet (12-inch cast iron preferred)
  • cutting board
  • kitchen tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.