CookSnap is coming soon — Join the waitlist →

Swordfish Involtini with Roasted Vegetables

Thin swordfish steaks stuffed with breadcrumbs and herbs, baked until tender alongside potatoes, carrots, broccoli, and tomato. A restaurant-worthy Italian dinner ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
48g
Swordfish Involtini with Roasted Vegetables
elegantsimpleitalianfishtendercrispyweeknightdate-night

Ingredients

  • 2 thick-cut (6 oz each) swordfish steaks
  • ½ cup panko breadcrumbs
  • ¼ cup parmesan cheese, grated
  • 2 tbsp fresh parsley, chopped
  • ½ lb potatoes, halved
  • 1 cup each (mixed) carrots, broccoli, tomato halves
  • 1 whole lemon

Instructions

  1. 1

    Heat oven to 400°F. Toss potatoes, carrots, broccoli, and tomato halves with olive oil, salt, and pepper on a sheet pan.

  2. 2

    Mix panko, parmesan, parsley, minced garlic, salt, and pepper in a small bowl until breadcrumb mixture is moist.

  3. 3

    Butterfly each swordfish steak by slicing horizontally without cutting all the way through, then opening like a book.

  4. 4

    Divide breadcrumb filling between the two steaks, pack gently into the center, then fold back over and secure with a toothpick.

  5. 5

    Nestle involtini among the vegetables, drizzle everything with olive oil, and bake until swordfish is opaque, 12–14 minutes.

  6. 6

    Serve immediately with lemon wedges alongside.

Tools you’ll need

  • sheet pan
  • small mixing bowl
  • sharp knife
  • toothpicks
  • oven set to 400°F

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.