CookSnap is coming soon — Join the waitlist →
Back to recipes

Roasted Branzino with Lemon and Herbs

Whole branzino roasted until the flesh is delicate and flaky, with a crisp skin and bright lemon-herb butter. A restaurant-quality Italian seafood dish that takes just 25 minutes from oven to table.

Total time
25 min
Servings
2
Calories
320
Protein
38g
Roasted Branzino with Lemon and Herbs
elegantsimpleitalianfishcrispytenderflakyweeknight

Ingredients

  • 2 fish (about 1 pound each) whole branzino (or sea bass), cleaned and gutted
  • 3 tablespoons butter
  • 1 whole lemon
  • 4 sprigs fresh rosemary sprigs
  • 4 sprigs fresh thyme sprigs
  • 2 cloves garlic clove
  • 1 teaspoon salt
  • ½ teaspoon black pepper

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light goes out or you hear the preheat beep, about 10 minutes.

  2. 2

    Pat both branzino completely dry inside and outside using paper towels—this helps the skin crisp in the oven.

  3. 3

    Place the lemon on a cutting board and slice it crosswise into 1/4-inch-thick rounds, like slicing a coin.

  4. 4

    Mince the garlic cloves until the pieces are smaller than a grain of rice, about the size of pencil-tip dots.

  5. 5

    Arrange the branzino on a 12-inch × 18-inch sheet pan so they lie flat and do not touch each other.

  6. 6

    Sprinkle the salt and black pepper evenly over both fish, inside the cavity and on the skin.

  7. 7

    Divide the lemon slices, rosemary sprigs, thyme sprigs, and minced garlic between the two fish cavities, distributing them evenly inside each belly.

  8. 8

    Slice the butter into three pats and place one pat on top of each fish, then place the sheet pan in the oven.

  9. 9

    Roast for 12–14 minutes until the skin looks crispy and golden, the flesh near the backbone turns opaque white when you peek inside with a fork, and the eyes look milky.

  10. 10

    Remove the sheet pan from the oven—the pan and fish will be very hot, so use oven mitts.

  11. 11

    Slide each fish onto a warm plate using a wide spatula, tilting the sheet pan gently to help.

  12. 12

    Drizzle any browned butter and pan juices remaining on the sheet pan over each fish.

Tools you’ll need

  • oven
  • 12-inch × 18-inch sheet pan
  • paper towels
  • cutting board
  • chef's knife
  • oven mitts
  • wide spatula
  • warm dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.