CookSnap is coming soon — Join the waitlist →

Spicy Kerala Egg Roast with Charred Onions

Crispy fried eggs tossed with a fiery onion-tomato masala and charred shallots—bright, tangy, and ready in 15 minutes. Serve with lemon wedges and fresh green chilis for authentic Kerala heat.

Total time
15 min
Servings
2
Calories
285
Protein
14g
Spicy Kerala Egg Roast with Charred Onions
comfortboldindianvegetarianeggscrispytenderweeknight

Ingredients

  • 4 whole eggs
  • 3 medium shallots, thinly sliced
  • 1 medium tomato, diced
  • 2 whole green chilis, chopped
  • ½ whole lime (juiced)
  • 8 leaves curry leaves, fresh

Instructions

  1. 1

    Heat 3 tbsp oil in a large skillet over medium-high. Working in two batches, fry eggs sunny-side-up until whites are set but yolks jiggle, ~3 minutes per batch. Transfer to a plate.

  2. 2

    In the same skillet, add shallots and cook, stirring often, until edges blacken and char, ~4 minutes.

  3. 3

    Add tomato, green chilis, and curry leaves. Stir constantly until tomato softens and mixture is fragrant, ~2 minutes.

  4. 4

    Return fried eggs to the skillet, breaking yolks gently to mix with the masala. Squeeze lime juice over top and toss once to coat.

  5. 5

    Season with salt and black pepper to taste. Serve immediately with lemon wedges on the side.

Tools you’ll need

  • 12-inch skillet
  • spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.