CookSnap is coming soon — Join the waitlist →

Ghee Roast Dosa with Sambar & Chutneys

Crispy, golden ghee-roasted dosa with warm sambar and fresh coconut chutney. A complete South Indian dinner in 25 minutes using store-bought dosa batter and sambar paste—no fermenting required.

Total time
25 min
Servings
2
Calories
420
Protein
6g
Ghee Roast Dosa with Sambar & Chutneys
comfortcasualindianvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1 cup store-bought dosa batter (or dosa mix prepared)
  • 4 tbsp ghee
  • 2 tbsp sambar powder or sambar paste
  • 1.5 cups boiling water
  • 1 whole potato (medium, diced small)
  • ½ whole onion (medium, thinly sliced)
  • ½ cup fresh grated coconut (or unsweetened frozen, thawed)
  • 1 whole green chili (finely chopped)

Instructions

  1. 1

    Heat 1 tbsp ghee in a skillet over medium. Add diced potato and cook 5–6 minutes until golden and tender, stirring occasionally.

  2. 2

    Stir in sambar powder or paste and cook 1 minute until fragrant. Pour in boiling water, bring to a simmer, and cook 3 minutes until broth is hot.

  3. 3

    Pour sambar into bowls and set aside. Wipe the skillet clean. Heat 2 tbsp ghee over medium-high until it shimmers.

  4. 4

    Pour a thin layer of dosa batter into the skillet, spreading it into a thin round with the back of a spoon. Cook until the edges curl and the bottom is golden, ~2 minutes.

  5. 5

    Drizzle 0.5 tbsp ghee around the edges of the dosa. Flip and cook the other side until crispy and golden, ~1 minute. Slide onto a plate.

  6. 6

    Mix coconut, green chili, and salt in a small bowl to make a quick chutney. Serve dosa with sambar, chutney, and fried onions on the side.

Tools you’ll need

  • 12-inch non-stick or cast iron skillet
  • small saucepan
  • wooden or silicone spatula
  • small mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.