CookSnap is coming soon — Join the waitlist →

Ghee Roast Dosa with Potato Masala & Sambhar

Crispy, buttery dosa with caramelized edges, served with spiced potato masala, tangy sambhar, and trio of chutneys. A complete South Indian dinner plated restaurant-style in under 20 minutes.

Total time
18 min
Servings
2
Calories
480
Protein
8g
Ghee Roast Dosa with Potato Masala & Sambhar
comfortsatisfyingindianvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1 cup store-bought dosa batter
  • 3 tbsp ghee, divided
  • 1 medium potatoes, diced small
  • ½ medium onion, finely sliced
  • 1 tsp store-bought sambhar powder
  • ½ cup store-bought coconut chutney

Instructions

  1. 1

    Heat 1 tbsp ghee in a nonstick skillet over medium-high until shimmering. Add diced potato and cook, stirring occasionally, until golden and crispy, about 6 minutes.

  2. 2

    Stir in sambhar powder and sliced onion. Cook 1 minute until fragrant, then transfer to a plate. Wipe skillet clean.

  3. 3

    Heat remaining 2 tbsp ghee over medium-high until it pools and shimmers, about 45 seconds.

  4. 4

    Pour 1/4 cup dosa batter onto skillet and spread in a thin circle with the back of a ladle. Cook without moving until bottom edges turn golden and curl, about 2 minutes.

  5. 5

    Flip dosa and cook the other side for 1 minute until crispy. Slide onto a plate.

  6. 6

    Serve dosa with potato masala on the side, coconut chutney, and sambhar for dipping. Repeat steps 3–5 for second dosa.

Tools you’ll need

  • 12-inch nonstick skillet or cast iron
  • ladle
  • spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.