CookSnap is coming soon — Join the waitlist →
Back to recipes

Thepla, Pithla & Thecha — Gujarati Spiced Plate

Crispy fenugreek flatbreads, garlicky chickpea curry, spicy cilantro chutney, and onion on one plate. A complete Gujarati dinner that tastes homemade in under 20 minutes.

Total time
18 min
Servings
2
Calories
425
Protein
14g
Thepla, Pithla & Thecha — Gujarati Spiced Plate
comfortwholesomeindianvegetarianveganchickpeascrispysoft

Ingredients

  • 1.5 cups whole wheat flour
  • ¼ cup fenugreek leaves (methi), dried or fresh, finely chopped
  • ½ cup chickpea flour (besan)
  • 1 can (15 oz) canned or cooked chickpeas, drained
  • 1 bunch + 2 cloves fresh cilantro, green chili, garlic (for thecha)
  • 1 medium red onion, sliced thin

Instructions

  1. 1

    Mix whole wheat flour, methi, 0.25 tsp turmeric, 0.5 tsp salt, and a pinch of cayenne pepper in a bowl.

  2. 2

    Add water 2 tbsp at a time, kneading until soft and pliable, about 3 minutes. Let rest 2 minutes.

  3. 3

    For pithla: Heat 1 tbsp oil in a skillet, add chickpea flour, cook 1 minute, then add 0.75 cup water and simmer 4 minutes until thickened.

  4. 4

    For thecha: Grind cilantro, green chili, garlic, salt, and 1 tbsp oil into a coarse paste; set aside.

  5. 5

    Divide dough into 4 balls, roll each into a thin round, and pan-fry in dry skillet 60 seconds per side until crispy and spotty.

  6. 6

    Plate thepla, top with warm pithla, dollop thecha on the side, and scatter raw onion over top. Serve immediately.

Tools you’ll need

  • medium mixing bowl
  • 12-inch nonstick skillet or cast iron
  • mortar and pestle or food processor
  • measuring cups and spoons
  • rolling pin and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.