Spiced Gram Flour Flatbread
Crispy-outside, tender missi roti made from gram flour, caramelized onions, and warm spices. Ready in 20 minutes with a skillet and no yeast.
- Total time
- 20 min
- Servings
- 2
- Calories
- 185
- Protein
- 7g
comfortwholesomeindianvegetarianveganchickpeascrispytender
Ingredients
- 1 cup gram flour (besan)
- 1 medium yellow onion, finely diced
- 1 whole green chili, minced
- ½ tsp cumin seeds
- ½ cup water
- ¼ cup fresh cilantro, chopped
Instructions
- 1
Mix gram flour, onion, green chili, cumin seeds, and cilantro in a bowl.
- 2
Add water slowly, stirring until a thick but pourable batter forms.
- 3
Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.
- 4
Pour 0.25 cup batter onto the skillet and spread into a 6-inch round with the back of a spoon.
- 5
Cook 3–4 minutes until the bottom is golden and edges curl away from the pan.
- 6
Flip and cook the other side 2–3 minutes until lightly crispy. Serve hot.
Tools you’ll need
- mixing bowl
- 12-inch non-stick skillet
- spoon or rubber spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
