20-Min Spiced Beef Flatbreads
Crispy store-bought naan or pita topped with a quick-seared, spiced ground beef mixture and fresh herbs. Middle Eastern street food energy, ready in 20 minutes.
- Total time
- 20 min
- Servings
- 2
- Calories
- 420
- Protein
- 24g
casualquickmiddle-easternbeefcrispytenderweeknightmain-dish
Ingredients
- ½ lb ground beef
- 4 pieces naan or pita flatbread
- 2 tbsp tomato paste
- 1 tsp sumac or dried oregano
- ½ tsp paprika
- ½ cup fresh parsley and mint, chopped
- 1 whole lemon
Instructions
- 1
Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.
- 2
Add ground beef, breaking it up with a spoon, and cook until no pink remains, ~6 minutes.
- 3
Stir in tomato paste, sumac, paprika, salt, and pepper; cook 1 minute until fragrant.
- 4
Warm flatbreads in the skillet 30 seconds per side, then transfer to a plate.
- 5
Spoon beef mixture onto each flatbread and top with fresh herbs.
- 6
Squeeze lemon over the top and serve immediately.
Tools you’ll need
- 12-inch skillet
- spoon or wooden spoon
- knife and cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
