CookSnap is coming soon — Join the waitlist →
Back to recipes

Soy-Ginger Tuna Poke Bowl

Fresh sushi-grade tuna marinated in a bright soy-ginger sauce, served over warm sushi rice with crisp vegetables and avocado. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
410
Protein
32g
Soy-Ginger Tuna Poke Bowl
freshlightjapanesegluten-freefishtendercrispyweeknight

Ingredients

  • 3 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 1 tbsp ginger, minced
  • 1 tsp sesame oil
  • 12 oz sushi-grade ahi tuna, 1-inch cubes
  • 2 cups sushi rice, cooked
  • 1 medium cucumber, cut into thin matchsticks
  • 1 whole avocado
  • 2 tbsp sesame seeds and sliced scallions (optional garnish)

Instructions

  1. 1

    In a small bowl, pour 3 tablespoons soy sauce, 1 tablespoon rice vinegar, 1 tablespoon minced ginger, and 1 teaspoon sesame oil, then stir until combined.

  2. 2

    Cut the tuna into 1-inch cubes by slicing lengthwise with the grain of the meat, then crosswise, so each piece looks like a small dice.

  3. 3

    Place the tuna cubes in a shallow bowl and pour the soy-ginger marinade over them, stirring gently to coat every piece.

  4. 4

    Let the tuna sit at room temperature for 5 minutes while you prep the vegetables, allowing the marinade flavors to soak in.

  5. 5

    Place 1 cup of warm sushi rice into a bowl, spreading it so it covers the bottom in an even layer.

  6. 6

    Using a spoon, scoop the marinated tuna and all of its liquid onto the center of the rice in a small mound.

  7. 7

    Slice the avocado in half lengthwise around the pit, twist the halves apart, then scoop the flesh into crescents using a spoon.

  8. 8

    Arrange the avocado slices and cucumber matchsticks in separate piles around the tuna, leaving space between each ingredient.

  9. 9

    Sprinkle sesame seeds and sliced scallions over the bowl if desired, then serve immediately.

Tools you’ll need

  • small mixing bowl
  • shallow serving bowl
  • cutting board
  • sharp chef's knife
  • spoon
  • large bowl for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.