Soy Butter Pasta
Silky Japanese-style pasta tossed in a simple umami sauce of butter and soy, finished with crispy scallions. Ready in under 15 minutes—the kind of weeknight dinner that feels fancy but takes no effort.
- Total time
- 12 min
- Servings
- 2
- Calories
- 420
- Protein
- 13g
simplesatisfyingjapanesevegetariansilkytenderweeknightpasta
Ingredients
- 8 oz pasta (spaghetti or linguine)
- 3 tbsp butter
- 2 tbsp soy sauce
- 3 stalks scallion, sliced thin
Instructions
- 1
Boil salted water in a large pot, then add pasta and cook until al dente.
- 2
Reserve 1/4 cup pasta water, then drain the pasta.
- 3
Return the empty pot to medium heat and melt butter, then add soy sauce.
- 4
Add the cooked pasta and toss, adding pasta water 1 tbsp at a time until silky.
- 5
Top with scallions and serve immediately.
Tools you’ll need
- large pot
- colander
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
