CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Herbed Cheese Pasta

Boursin-style herbed cream cheese melts into hot pasta with cherry tomatoes for a silky, garlicky dinner that comes together in under 15 minutes. No cream needed—just the cheese, pasta water, and heat.

Total time
12 min
Servings
2
Calories
520
Protein
16g
Creamy Herbed Cheese Pasta
comfortsimplefrenchvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz pasta (penne or fusilli)
  • 5 oz herbed cream cheese (Boursin-style)
  • 1.5 cups cherry tomatoes, halved
  • 2 cloves garlic, minced

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 9 minutes.

  2. 2

    Reserve 1 cup pasta water, then drain the pasta.

  3. 3

    Heat 1 tbsp oil in the same pot over medium, then add garlic and cook until fragrant, 30 seconds.

  4. 4

    Add cherry tomatoes, then cook until edges start to soften, about 2 minutes.

  5. 5

    Return pasta to pot, add herbed cream cheese, then stir with 0.5 cup pasta water until silky and creamy.

  6. 6

    Serve hot, adding more pasta water if needed to loosen.

Tools you’ll need

  • large pot for boiling pasta
  • wooden spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.